PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr000044.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 537aa    MW: 60188.2 Da    PI: 6.2332
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr000044.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS419.13.9e-1281665361374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l+++L++cA+a+s++++ +a +l++ l +++s +g+pmqRl ay++e+L+arl +s+s++yk+l+++  +   sse ++++++++ ++P+ +f++l a
  Pbr000044.1 166 LKNVLIDCARAISENEFDNAISLMEVLGQMVSVSGEPMQRLGAYMLEGLRARLEGSGSSIYKTLKCEVPT---SSELMSYMSVLYRICPYWRFAYLSA 260
                  5789*****************************************************************9...9999********************* PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                  N  I ea+e+e r+HiiDf+i qG QW++L+q La++p+gpp++RiTgv++ +s+  +   l+ + +rL+++A++++vpfefn+ +a   +++el++L
  Pbr000044.1 261 NVVIREALENEPRIHIIDFQIAQGSQWIPLIQDLACQPGGPPRIRITGVDDTQSEhaRGGGLHIVSKRLSELAASCNVPFEFNA-AAMCGSEVELHNL 357
                  ***************************************************9988889999***********************.899********** PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                  r++pgEa+aVn+ + lh+++desvs+e++rd++L+lvkslsPkvv++veqe+++n++ F  rf+e ++yy+a+f+s+++  pr+++eri+ E ++++r
  Pbr000044.1 358 RIQPGEAIAVNFPYVLHHMPDESVSTENHRDRLLRLVKSLSPKVVTLVEQESNTNTSLFYSRFVEMVDYYTAMFESIDVARPRDDKERISAEMHCVAR 455
                  ************************************************************************************************** PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +ivn+vacegaer+erhe ++kWr+rl++ GF+p+pls k+++ ++ ll++++++ +r++e +g+l+l+W++r++ + SaWr
  Pbr000044.1 456 DIVNMVACEGAERVERHELFGKWRSRLMMDGFTPYPLSPKVTEAIRVLLKEYHGN-FRIQEANGALYLTWMQRAMATSSAWR 536
                  *****************************************************77.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.455140517IPR005202Transcription factor GRAS
PfamPF035141.3E-125166536IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MKASQQHRGV ALYHQPVQQI DRCGFQILEK SMYPDTGSQG NNLSFQNYKD DKEQFFTLDS  60
SPATAFLTCD SPSAISGLSN RSPFSPQGSH SCFSDQHHSS GNNYGSPISG CSIIVDDDFK  120
SKLREMEVSL LGPDSDIVDS HFCSHRSGMA RWSHSQIAET IPKLNLKNVL IDCARAISEN  180
EFDNAISLME VLGQMVSVSG EPMQRLGAYM LEGLRARLEG SGSSIYKTLK CEVPTSSELM  240
SYMSVLYRIC PYWRFAYLSA NVVIREALEN EPRIHIIDFQ IAQGSQWIPL IQDLACQPGG  300
PPRIRITGVD DTQSEHARGG GLHIVSKRLS ELAASCNVPF EFNAAAMCGS EVELHNLRIQ  360
PGEAIAVNFP YVLHHMPDES VSTENHRDRL LRLVKSLSPK VVTLVEQESN TNTSLFYSRF  420
VEMVDYYTAM FESIDVARPR DDKERISAEM HCVARDIVNM VACEGAERVE RHELFGKWRS  480
RLMMDGFTPY PLSPKVTEAI RVLLKEYHGN FRIQEANGAL YLTWMQRAMA TSSAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-561705368375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ3976380.0JQ397638.1 Malus zumi SCL mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009348924.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A0U1VL410.0A0A0U1VL41_9R
STRINGGLYMA15G12320.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43773360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13